PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC01G06850.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 319aa    MW: 34499.3 Da    PI: 6.6593
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC01G06850.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.74e-11185230550
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                      kr +r   NR +A+rsR RK+++i eLe+ v +L++e +aL  ++ 
  OPUNC01G06850.1 185 KRVKRILANRQSAQRSRVRKLQYISELERSVTSLQTEVSALSPRVA 230
                      8999*********************************999987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.6E-14181245IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.76183239IPR004827Basic-leucine zipper domain
PfamPF001705.1E-10185235IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.76E-11185239No hitNo description
Gene3DG3DSA:1.20.5.1704.6E-14185239No hitNo description
CDDcd147032.36E-23186236No hitNo description
PROSITE patternPS000360188203IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MAQLPPKIPT MATAWPEFGS GHHHHAAHGH HHQRSPSMGA FLAAPLPPFP LPPPAPANGG  60
AQQHHQPSWV DEFLDFSAAK RGAHRRSVSD SVAFLDPVSD DNAGVGAHDF DRLDDDQLMS  120
MFSDDLQPPP PQQQPAAPAA SASSPSDHNS MNDEKQDKGE TEEAQSECDG ATPGQPASPA  180
TVDPKRVKRI LANRQSAQRS RVRKLQYISE LERSVTSLQT EVSALSPRVA FLDHQRSLLT  240
LGNSHLKQRI AALAQDKIFK DAHQEALKKE IERLRQIYHQ QSLKNAESQP ADAAPVRGSD  300
KADLIASEGT AAAAPCPPP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1009440.0AK100944.1 Oryza sativa Japonica Group cDNA clone:J023138F18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635844.11e-175PREDICTED: basic leucine zipper 2-like
SwissprotQ5QNI51e-136BZP02_ORYSJ; Basic leucine zipper 2
TrEMBLA0A0E0JFH50.0A0A0E0JFH5_ORYPU; Uncharacterized protein
STRINGSi002311m1e-147(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132238125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.11e-98bZIP family protein